Details for Capsella Locus Carubv10014984m

Position : scaf_3 ( 5`- 9346238 .. 9347193 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014984m

Protein [Map View]
MATSNDQTNTKSSHSHTLLLLLIFLSLLLFASFTIPVTRRPQFTSTAAPFKRVLLEPSVSASSTMDLRPKARTRRSRTSR
RREFGNDAHEVPSGPNPISN*

DNA
ATGGCAACATCAAATGACCAAACCAATACCAAATCATCACATTCTCATACTCTTCTCCTTCTCCTCATCTTCTTATCTCT
CTTACTCTTTGCTAGCTTTACAATCCCCGTGACCCGTCGACCTCAGTTCACATCTACGGCTGCTCCCTTCAAGAGGGTTC
TTCTTGAACCTTCAGTTTCCGCTTCATCAACAATGGATCTACGTCCTAAGGCTCGCACACGACGCAGCCGTACTTCTAGA
AGGAGAGAGTTTGGGAATGATGCTCATGAGGTTCCTAGTGGTCCAAACCCTATTTCCAACTAG