Details for Capsella Locus Carubv10014961m

Position : scaf_3 ( 5`- 2456822 .. 2458093 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014961m

Protein [Map View]
MKLVRFLMKLNNETVSIELKNGTVVHGTITGVDVSMNTHLKTVKMSLKGKNPVTLDHLSLRGNNIRYYILPDSLNLETLL
VEDTPRVKPKKPVAGKPVGRGRGRGRGRGRGRGR*

DNA
ATGAAGCTCGTCAGGTTTTTGATGAAGTTAAACAATGAAACTGTGTCGATCGAGCTGAAGAACGGGACTGTTGTCCATGG
AACCATCACTGGTGTTGATGTGAGCATGAATACTCACTTGAAGACAGTTAAAATGAGTCTGAAGGGGAAAAACCCAGTAA
CACTTGATCATCTCAGCTTGAGGGGTAACAATATCCGATACTACATTCTTCCTGATAGCTTGAACCTGGAGACTTTACTT
GTGGAAGACACTCCTAGAGTTAAGCCTAAGAAGCCTGTTGCTGGCAAACCTGTTGGACGCGGTCGTGGACGTGGGCGTGG
GCGTGGTCGTGGCAGAGGTCGTTAG