Details for Capsella Locus Carubv10014915m

Position : scaf_3 ( 5`- 750598 .. 751516 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014915m

Protein [Map View]
MALEWVVLGYAAAAEAIMVVLLTMPGLDGLRKGLVAVTRNLLKPFLSIVPFCLFLLMDIYWKYETMPSCEGDSCTPSEHL
RHQKSMMKSQRNALLIAAALVFYWILYSVTNLVVRIEHLNQRIERLRNKD*

DNA
ATGGCGCTCGAATGGGTTGTTTTAGGTTACGCAGCGGCGGCTGAAGCGATCATGGTGGTGCTATTGACGATGCCAGGACT
CGACGGACTCCGCAAGGGATTAGTCGCCGTCACGCGTAATCTCCTCAAACCGTTTCTCTCCATAGTTCCTTTCTGCCTCT
TCTTATTAATGGACATCTACTGGAAGTACGAGACGATGCCTTCGTGCGAAGGCGATTCCTGCACACCGTCGGAGCATCTT
CGTCACCAGAAATCCATGATGAAATCCCAGCGAAACGCGCTTCTCATCGCGGCTGCCCTTGTCTTCTACTGGATCCTTTA
CTCAGTGACCAATTTGGTTGTCAGGATCGAGCATCTTAACCAGAGGATCGAGAGGCTCAGGAACAAGGATTGA