Details for Capsella Locus Carubv10014912m

Position : scaf_3 ( 5`- 4665379 .. 4666904 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014912m

Protein [Map View]
MTGSGASPDLLLTWSEPPATAVKRNDAVSSVTSFVKHIVRGREVVADTNRRRRPLTDSTKMSVKPAVALRGILVGGVAIF
AKVAGAMKAAGGVKLGAAATAMTVAATAAVSGGSKQEQKQDASKAPPPSK*

DNA
ATGACTGGTTCTGGTGCGTCCCCGGATCTTTTATTGACGTGGTCTGAACCGCCGGCGACGGCCGTGAAACGAAACGACGC
CGTTAGTAGCGTTACAAGCTTCGTTAAGCATATTGTGAGAGGGAGAGAAGTTGTCGCCGATACCAATAGAAGAAGAAGGC
CATTGACGGACTCAACAAAAATGTCGGTGAAACCCGCAGTCGCTTTGAGAGGTATCCTAGTAGGTGGAGTGGCGATATTT
GCGAAAGTTGCGGGTGCAATGAAAGCTGCTGGAGGTGTTAAGCTTGGTGCAGCTGCTACAGCTATGACCGTGGCTGCAAC
TGCTGCCGTGAGTGGAGGATCTAAGCAAGAACAAAAGCAAGATGCTTCTAAAGCACCACCACCTTCTAAATAA