Details for Capsella Locus Carubv10014900m

Position : scaf_3 ( 5`- 3996876 .. 4000249 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014900m

Protein [Map View]
MAAPFTLRKIGVPPNSANLTEARRRVFDFFRAACRSIPTIMDIYNLQDVVAPSQLRFAISAQIRNNSHITDPKVIDLLLF
KGMEELTDIVDHAKQRHHIIGQYVVGEGLIQNTGNKDQGRTDFLKNFYTSNYF*

DNA
ATGGCGGCACCTTTCACGTTGAGGAAGATTGGTGTTCCACCGAACTCAGCTAACCTGACGGAAGCTCGCCGCCGTGTTTT
CGATTTCTTCAGAGCCGCCTGTAGATCTATCCCCACAATCATGGACATTTACAATCTTCAAGATGTCGTCGCTCCTTCTC
AGCTTCGATTTGCAATTTCTGCTCAGATTCGGAATAACTCCCACATCACCGACCCGAAGGTAATTGATCTTCTATTATTC
AAGGGAATGGAAGAGCTGACTGACATTGTGGATCACGCAAAGCAGCGCCACCACATCATAGGTCAATATGTGGTAGGTGA
AGGGCTCATACAGAATACTGGAAACAAAGATCAAGGAAGGACTGATTTTCTTAAGAATTTCTACACCAGCAACTACTTTT
GA