Details for Capsella Locus Carubv10014892m

Position : scaf_3 ( 5`- 6147852 .. 6148721 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014892m

Protein [Map View]
MAANACLPSPAAMTVRPEEGVPNSKSTQSQPRLYLTKPSWIVRTQSGVKACTKRKEKDRCVICHGTGRVDCFNCRGKGRT
NCVDEEMLPKGQWPKWCKGCGGSGLSDCSRCLGTGEYRYIMGFRFLKQDDDVDPP*

DNA
ATGGCGGCGAACGCGTGTCTACCTTCGCCGGCAGCGATGACAGTCCGGCCAGAGGAAGGCGTTCCGAATTCGAAATCTAC
GCAGAGCCAACCTAGGCTCTATCTCACCAAACCTTCATGGATAGTCAGAACTCAGTCCGGAGTTAAGGCTTGTACAAAGA
GAAAGGAGAAAGACCGATGCGTAATTTGCCATGGAACTGGAAGAGTCGATTGTTTCAATTGTCGTGGGAAAGGGAGGACT
AATTGTGTGGATGAGGAAATGCTTCCAAAAGGACAATGGCCCAAATGGTGCAAGGGCTGTGGAGGAAGTGGATTAAGTGA
CTGTTCTCGCTGTCTTGGCACTGGAGAGTACAGATACATTATGGGCTTCCGCTTCTTAAAACAAGACGATGATGTCGATC
CTCCATAA