Details for Capsella Locus Carubv10014866m

Position : scaf_3 ( 5`- 377511 .. 378655 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014866m

Protein [Map View]
MATGKTVKDVSPHDFVKAYASHLKRSGKIELPTWTDIVKTGKLKELAPYDPDWYYIRAASMARKVYLRGGLGVGAFRRIY
GGSKRNGSRPPHFCKSSGGIARHILQQLETMNIVELDTKGGRRITSSGQRDLDQVAGRIAVEP*

DNA
ATGGCGACTGGTAAAACTGTGAAAGACGTCTCACCCCATGACTTCGTCAAGGCTTACGCCTCTCATCTCAAGCGATCTGG
CAAGATTGAGCTTCCCACATGGACCGACATTGTGAAGACTGGAAAGTTGAAGGAGCTTGCCCCATATGATCCAGACTGGT
ACTACATCAGAGCTGCATCTATGGCAAGGAAGGTTTACCTTAGGGGAGGTCTTGGTGTTGGTGCTTTCCGAAGAATCTAC
GGAGGCAGCAAGAGAAACGGTAGTCGCCCACCACACTTCTGCAAAAGCAGTGGTGGTATTGCCCGTCACATCCTCCAGCA
GTTGGAGACAATGAACATTGTTGAACTCGACACCAAAGGAGGAAGAAGAATCACTTCCAGTGGCCAACGGGATTTGGACC
AGGTTGCTGGCCGTATTGCAGTTGAACCTTGA