Details for Capsella Locus Carubv10014855m

Position : scaf_3 ( 5`- 718780 .. 720604 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014855m

Protein [Map View]
QLNALFLVNDSPLPCLSLSLSLSIDFFTSEFLGVGAMASNLLKALIRSQILPASRRNFSVATTQLGIPTDDLVGNHTAKW
MQDRSKKSPMELINEVPPIKVDGRIAACEGDTNPALGHPIEFICLDQDEPAICKYCGLRYVQDHHH*

DNA
CAATTAAATGCGTTGTTCTTGGTAAACGATTCTCCTCTCCCCTGTCTCTCTCTCTCTCTCTCTCTCTCGATAGACTTCTT
CACCTCTGAATTTCTCGGTGTTGGAGCAATGGCGTCGAATCTCCTGAAAGCCCTAATCCGATCGCAGATTCTCCCAGCTT
CGAGGAGGAATTTTAGTGTGGCCACCACTCAACTCGGCATCCCGACAGACGATCTAGTCGGCAACCACACCGCCAAATGG
ATGCAGGATAGAAGCAAGAAGTCACCAATGGAACTGATCAATGAGGTTCCACCTATCAAAGTTGATGGAAGGATTGCTGC
TTGTGAAGGAGACACCAATCCAGCCCTTGGTCATCCAATTGAGTTCATATGCCTAGACCAAGATGAGCCTGCGATTTGCA
AGTACTGTGGCCTTCGTTACGTCCAAGATCATCATCACTAA