Details for Capsella Locus Carubv10014841m

Position : scaf_3 ( 5`- 2164794 .. 2166156 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014841m

Protein [Map View]
MLDPTDKVIESEAMKTSTDAIEEHSSSSSNIISNEKKSCAICGTSKTPLWRGGPAGPKSLCNACGIRNRKKRRTLISNRS
EDKKTKNKKNQSRNPKLGDSLKQRLMELGREVMMQRSTAEKQRRNKLGEEEQAAVLLMALSYASSVYA*

DNA
ATGCTAGATCCCACCGATAAAGTTATCGAATCAGAAGCCATGAAAACATCAACAGATGCGATCGAAGAACACAGCAGCAG
TAGCAGTAATATCATCAGCAACGAGAAGAAGAGCTGTGCCATTTGTGGTACTAGCAAAACCCCTCTTTGGCGTGGCGGTC
CCGCCGGTCCCAAGTCGCTCTGTAACGCATGCGGGATCAGAAACAGGAAGAAAAGACGAACGCTGATCTCGAACAGATCA
GAAGATAAGAAAACGAAGAATAAGAAGAATCAAAGCAGAAATCCGAAGTTGGGTGACTCATTGAAACAGAGACTGATGGA
ACTGGGGAGAGAAGTGATGATGCAGAGATCAACGGCTGAGAAACAACGGAGGAATAAGCTCGGCGAAGAAGAGCAAGCCG
CCGTCTTACTCATGGCTCTCTCTTATGCTTCTTCCGTCTATGCTTAG