Details for Capsella Locus Carubv10014810m

Position : scaf_3 ( 5`- 782151 .. 783210 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014810m

Protein [Map View]
MGKTRTVGVGMDYSPTSKLALRWTAENLLEDGDTVILIHVQPQNADHTRKILFEDTGSPLVPLEEFREVNFSKQYGLAYD
PEVLDVLDTLSRAKKVKVVAKVYWGDPREKLCDAVENLKLDSIVLGSRGLGSLKRMLLGSVSNHVVTNATCPVTVVKAN*

DNA
ATGGGAAAGACACGTACGGTGGGAGTAGGAATGGACTATTCTCCGACGAGCAAATTAGCTCTTCGGTGGACGGCTGAGAA
TCTCCTTGAAGACGGCGACACCGTCATCTTGATTCACGTCCAACCGCAAAACGCCGATCATACCCGCAAAATCCTCTTCG
AGGACACCGGTTCACCGCTGGTTCCTTTGGAGGAATTTAGAGAGGTTAATTTCTCTAAACAGTATGGACTTGCTTACGAT
CCTGAGGTTCTTGATGTTCTTGATACTCTCTCTCGGGCTAAAAAGGTGAAGGTAGTAGCAAAGGTGTATTGGGGAGATCC
AAGGGAGAAACTTTGTGATGCCGTCGAGAATTTAAAACTTGATTCCATTGTTCTTGGCAGTCGAGGTTTGGGTTCTCTCA
AAAGGATGTTGCTGGGTAGTGTGAGCAATCATGTGGTGACAAATGCAACATGTCCAGTGACAGTTGTTAAGGCTAATTAA