Details for Capsella Locus Carubv10014808m

Position : scaf_3 ( 5`- 13420413 .. 13421844 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014808m

Protein [Map View]
KKNPITHLLKTLSLLSKSNKQKKTLKMKGGESKAEATSTDQRLKTRGRKPGKKTKKDPNQPKRPPSAFFVFLEDFRKEFN
LANPNNKSVATVGKAAGARWKSMTDEDKAPYVAKAESRKTEYLKTMQQYNMKLASGTNRGEEDDKSEVDEAGSEEEEEDD
D*

DNA
AAAAAAAACCCTATTACTCACTTGCTCAAAACGCTCTCTCTTCTCTCTAAGTCAAACAAGCAAAAAAAAACCCTAAAGAT
GAAAGGCGGCGAATCCAAAGCTGAAGCTACCAGCACTGATCAGAGACTCAAAACTAGAGGTAGGAAGCCTGGGAAGAAGA
CAAAGAAGGATCCAAATCAGCCTAAGAGACCTCCAAGTGCTTTCTTCGTCTTCCTTGAGGATTTCCGAAAAGAGTTTAAC
CTGGCGAATCCTAACAACAAATCCGTCGCTACTGTTGGGAAGGCTGCTGGAGCTAGATGGAAGTCTATGACTGATGAAGA
TAAAGCTCCTTACGTTGCCAAGGCTGAGAGCAGGAAGACTGAATATCTTAAGACTATGCAACAGTACAACATGAAACTGG
CTAGTGGAACCAATAGAGGTGAAGAGGATGACAAGTCTGAAGTGGATGAAGCAGGGAGCGAAGAGGAGGAGGAAGACGAC
GATTGA