Details for Capsella Locus Carubv10014794m

Position : scaf_3 ( 5`- 5447928 .. 5449419 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014794m

Protein [Map View]
MSRPGDWNCRSCSHLNFQRRDSCQRCGDSRSGPGGVGGLDFGGYGGRAMSAFGFTTGSDVRPGDWYCTVGNCGTHNFASR
STCFKCGTFKDETGAGGGGGGIGGPAMFDADVMRSRVPGGNGGRSSWKSGDWICTRLGCNEHNFASRMECFRCNAPRDFS
NRTSF*

DNA
ATGAGCAGACCCGGAGATTGGAACTGCAGGTCATGCAGCCACCTCAACTTCCAGCGCCGTGATTCTTGCCAGCGATGCGG
TGACTCTCGTTCCGGCCCCGGTGGAGTCGGTGGCTTAGACTTCGGCGGTTACGGCGGCAGAGCCATGTCTGCTTTCGGAT
TCACCACCGGGTCCGACGTTCGTCCAGGTGACTGGTACTGCACCGTCGGAAACTGCGGGACTCACAACTTCGCTAGTCGC
TCCACTTGCTTCAAATGCGGCACTTTCAAGGACGAGACCGGCGCTGGAGGTGGAGGCGGTGGCATCGGCGGTCCGGCCAT
GTTTGACGCTGACGTTATGAGGTCTAGAGTCCCCGGCGGTAACGGAGGCCGTTCCAGCTGGAAATCCGGCGACTGGATTT
GCACTAGGCTTGGTTGCAATGAGCACAACTTTGCAAGCAGAATGGAATGCTTCAGATGCAATGCACCAAGAGACTTCAGC
AACAGAACCTCTTTCTAA