Details for Capsella Locus Carubv10014793m

Position : scaf_3 ( 5`- 697214 .. 697849 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014793m

Protein [Map View]
MSGDGEKPAPAKLGDEQLAELREIFRSFDQNKDGSLTELELGSLLRSLGLKPSQDQLDTLIHKADRNNNGLVEFSEFVAL
VEPDLVKCPYTDEQLKAIFKMFDRDGNGYITAAELAHSMAKLGHALTAEELTGMIKEADRDGDGCIDFQEFVQAITSAAF
DNAWG*

DNA
ATGAGCGGCGACGGAGAGAAACCGGCGCCGGCGAAACTAGGCGACGAACAGCTGGCGGAGCTTCGGGAGATATTCAGATC
ATTTGACCAGAACAAAGATGGGAGCTTGACGGAGCTCGAGTTAGGCTCACTTCTAAGATCTCTCGGTTTAAAGCCGAGTC
AAGACCAGCTCGACACCTTGATCCATAAAGCTGATCGGAACAACAACGGGCTCGTCGAGTTCTCCGAGTTCGTCGCCCTC
GTCGAGCCGGATCTTGTCAAGTGTCCTTACACGGATGAGCAGCTTAAAGCCATCTTCAAAATGTTCGATCGCGACGGAAA
CGGTTACATAACGGCTGCTGAGTTGGCGCACTCGATGGCGAAGCTAGGTCACGCGTTGACGGCGGAGGAGCTAACCGGGA
TGATCAAGGAAGCAGATCGAGACGGCGACGGTTGTATCGATTTCCAAGAGTTTGTTCAGGCGATCACTTCAGCTGCATTT
GATAATGCTTGGGGTTGA