Details for Capsella Locus Carubv10014792m

Position : scaf_3 ( 5`- 6238622 .. 6239572 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014792m

Protein [Map View]
IKYPKNFTHGENMRRLPPWMLGGASTGEAAAARNVTESEAPKPKAEKRPRRNVKPKEKDLNLNSEEPKRVRRKIGDEANR
GNNNGPEIIQSVMTGPGNEDLTVDDLLSFAHEYVQSNQEVQTSKEDERSESMLVANESTSSQGGTRDSTAEDMLDLLMGP
YFKKR*

DNA
ATCAAGTATCCTAAAAATTTCACACACGGAGAGAATATGAGGCGGTTACCACCGTGGATGCTCGGTGGCGCGTCCACCGG
TGAAGCAGCAGCTGCACGCAACGTAACAGAATCAGAAGCTCCTAAACCAAAGGCGGAGAAGAGACCGAGAAGAAACGTGA
AACCCAAAGAAAAAGATTTAAATCTCAATTCTGAGGAACCTAAACGAGTCCGTAGGAAGATTGGAGATGAAGCTAATCGT
GGTAACAATAATGGTCCAGAGATAATTCAATCAGTGATGACTGGTCCAGGAAACGAAGATCTCACAGTTGATGACTTATT
AAGCTTTGCTCACGAGTATGTCCAAAGTAATCAAGAAGTCCAGACAAGCAAGGAGGATGAAAGGTCTGAATCCATGTTAG
TTGCGAATGAATCAACATCATCTCAAGGAGGAACCAGAGATTCAACAGCAGAGGACATGTTAGATCTGCTAATGGGTCCT
TATTTCAAGAAACGCTAG