Details for Capsella Locus Carubv10014791m

Position : scaf_3 ( 5`- 8872220 .. 8873985 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014791m

Protein [Map View]
LLFVFILSLPLFSLTTHCHFAKTLISPFRYLEMAFCNKLSGIWRQGVSQSSNVPVTSMLGSLRYMSTKLFIGGLSWGTDD
SSLKDAFSSFGDVTEATVIADRETGRSRGFGFVSYDSEDSANNAIKEMDGKELNGRNIRVNLANERPSAPRSSFGGGGGY
GGGGGGY*

DNA
CTACTCTTTGTCTTCATCCTCTCACTGCCTCTTTTCTCACTGACTACTCACTGTCACTTCGCAAAAACCCTAATTTCGCC
ATTCAGATATCTAGAAATGGCTTTTTGCAACAAGCTTAGTGGTATTTGGAGACAAGGTGTTTCTCAGAGCTCAAATGTTC
CAGTCACATCTATGCTTGGCTCTCTCCGTTACATGTCCACTAAGCTTTTTATTGGTGGTCTCTCGTGGGGAACTGATGAC
TCCTCCCTGAAGGACGCTTTCTCTAGCTTTGGTGATGTCACAGAAGCTACGGTGATTGCAGACAGAGAGACTGGGAGGTC
AAGGGGTTTTGGATTTGTCAGCTACGACAGTGAAGACTCCGCAAACAATGCCATCAAAGAAATGGATGGAAAGGAGCTGA
ATGGGAGGAACATCCGTGTGAACCTTGCTAACGAAAGACCGAGTGCCCCGAGATCATCATTCGGTGGTGGTGGTGGTTAC
GGTGGTGGAGGAGGTGGATACTAA