Details for Capsella Locus Carubv10014790m

Position : scaf_3 ( 5`- 1525969 .. 1529064 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014790m

Protein [Map View]
MHTFGYRANALLTFAITALAFICAIASFSDKFSNQNPSAEIQILNINRFKKQSHGNDEVSLTLDISADLQSLFTWNTKQL
FVFVAAEYETPKNSLNQVSLWDAIIPDKELAKFRIQVSNKYRFIDQGQNLRGKEFNLTLHWHVMPKTGKMFADKIVMPGY
SLPDAYR*

DNA
ATGCATACTTTTGGTTACAGAGCTAATGCTCTGCTCACTTTCGCAATCACGGCGCTTGCTTTCATTTGCGCAATCGCGTC
CTTCTCAGACAAATTCAGCAACCAAAACCCCTCTGCTGAGATCCAGATACTTAATATCAATCGGTTTAAGAAGCAATCTC
ATGGAAACGATGAGGTCAGCTTGACATTGGACATATCAGCAGACTTGCAGTCACTATTTACTTGGAACACCAAACAGCTT
TTTGTTTTCGTAGCAGCGGAGTATGAAACCCCGAAGAATTCCCTGAATCAGGTTTCTCTATGGGATGCCATAATCCCTGA
CAAGGAACTTGCCAAATTCCGAATTCAAGTCTCAAACAAGTACCGTTTCATTGATCAGGGACAGAATCTTCGCGGAAAAG
AATTCAACTTGACACTACATTGGCATGTGATGCCCAAGACCGGCAAGATGTTTGCTGACAAGATAGTCATGCCTGGTTAC
AGTTTACCTGATGCATACAGATGA