Details for Capsella Locus Carubv10014789m

Position : scaf_3 ( 5`- 4722315 .. 4725596 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014789m

Protein [Map View]
MYGKETKRWTNNEEEIGRTGREETSGYECSPHVTGVATFKCRNFSHVHTSKRSESLSILFFTFLCQTKAPTTMATVESPN
SVQKIVVHLRATGGAPILKQSKFKISGTDKFAKVIEFLRRQLHSDSLFVYVNSAFSPNPDESVIDLYNNFGFDGKLVVNY
ASSMAWG*

DNA
ATGTATGGGAAAGAGACGAAGAGATGGACCAATAATGAAGAGGAGATAGGGCGGACCGGCCGGGAAGAAACGAGTGGATA
CGAATGTAGCCCGCACGTGACGGGGGTGGCCACTTTTAAGTGTCGTAACTTCTCCCACGTGCACACGTCAAAACGCAGTG
AATCGTTGTCAATTTTGTTCTTTACTTTTCTCTGTCAAACCAAAGCCCCAACAACAATGGCGACTGTTGAATCTCCAAAC
TCTGTTCAGAAAATTGTTGTTCATCTAAGAGCTACCGGTGGTGCTCCGATACTGAAGCAATCTAAATTTAAGATTTCAGG
GACTGATAAGTTTGCTAAAGTGATTGAATTTCTAAGACGACAGCTTCACTCTGACTCATTGTTTGTGTATGTAAACAGCG
CTTTCTCGCCTAACCCGGATGAATCAGTCATTGATCTCTATAATAACTTTGGGTTTGATGGTAAATTGGTGGTTAACTAT
GCTAGTTCCATGGCATGGGGTTAA