Details for Capsella Locus Carubv10014788m

Position : scaf_3 ( 5`- 5783908 .. 5785719 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014788m

Protein [Map View]
MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVLGAVDVNIGANPSAEEGGEDEGVDDSVQKVVDIVDTFRLQEQP
TYDKKGFIAYIKKYIKLLTPKLSEEEQAVFKKGIEGATKYLLPRLGDFQFFVGEGMHDDSSLVFAYYKEGATNPTFLYFA
HGLKEVKC*

DNA
ATGTTGGTGTACCAAGATCTTCTCACCGGTGATGAGCTTCTGTCCGACTCTTTCCCTTACAAGGAGATTGAGAATGGAAT
CCTTTGGGAAGTTGAGGGAAAGTGGGTTGTCTTGGGAGCTGTAGATGTTAACATTGGTGCCAATCCATCTGCTGAAGAAG
GTGGTGAGGATGAGGGTGTTGATGACTCTGTCCAAAAGGTTGTTGACATTGTCGACACCTTCAGACTTCAGGAGCAACCA
ACTTATGACAAGAAGGGATTCATCGCTTATATTAAGAAATACATCAAGCTTTTGACACCCAAGCTCAGCGAGGAAGAGCA
AGCAGTCTTCAAGAAGGGTATTGAGGGAGCTACCAAGTATTTGCTCCCCAGGCTCGGTGACTTCCAATTCTTTGTTGGGG
AGGGGATGCACGATGACAGCTCTTTGGTCTTTGCTTACTACAAGGAGGGTGCAACAAACCCAACATTTTTGTACTTCGCA
CATGGTTTGAAGGAGGTCAAGTGCTGA