Details for Capsella Locus Carubv10014786m

Position : scaf_3 ( 5`- 4322814 .. 4323556 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014786m

Protein [Map View]
MKVNRSCELCRQKVTEVMHCVNGVYSVDFVGDDNSMKLKARVNPNILLAVIERYGEHGKITNLRFDGEVMTPRGGGGGYY
GQSGYYLPSCTAGSYYPNSSYSYPPPPPYAFTGNYAHPTADHAPRNPHTTPPSYTLPPPAPRPLYSFSYVEPQYRTSSSS
GRGRCVIM*

DNA
ATGAAAGTGAACAGAAGCTGCGAGCTTTGTCGGCAAAAAGTGACAGAAGTCATGCATTGTGTCAACGGAGTATACTCTGT
GGATTTTGTCGGAGACGACAACTCAATGAAACTAAAGGCGAGGGTAAACCCTAATATATTGTTGGCGGTTATTGAACGGT
ACGGCGAACATGGAAAGATCACCAATCTCCGTTTCGACGGAGAAGTTATGACTCCACGTGGCGGAGGCGGGGGCTATTAC
GGTCAATCAGGCTATTACCTTCCTTCCTGCACCGCCGGTAGTTATTATCCAAATTCTTCGTATTCGTATCCCCCTCCTCC
GCCGTATGCTTTTACCGGAAACTATGCTCACCCTACGGCGGATCATGCACCACGGAACCCGCATACAACACCTCCGTCGT
ATACTCTGCCTCCGCCAGCGCCAAGACCGTTGTATAGTTTCTCTTACGTAGAACCGCAGTATCGGACGTCGAGTTCGTCG
GGTAGAGGGCGTTGTGTGATCATGTGA