Details for Capsella Locus Carubv10014785m

Position : scaf_3 ( 5`- 8666871 .. 8668870 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014785m

Protein [Map View]
MEAAKKQSVTNQLLAVKAASGKTYSQLATETGLTNVYVAQLLRRQAQLKPDTVPKLKKALPALTDGLIDDMMSPPWRSYD
PNLIQEPTIYRLNEAVMHFGESIKEIINEDFGDGIMSAIDFYCSVDKIKGADGNNRVVVTLDGKYLSHSEQRTENMVSRL
NLKGSTSE*

DNA
ATGGAAGCGGCGAAGAAACAGAGTGTTACAAATCAGCTTCTCGCCGTGAAAGCAGCTTCCGGCAAGACTTATAGCCAATT
AGCGACGGAGACAGGTCTCACCAACGTCTACGTAGCTCAACTTCTCCGTCGTCAAGCTCAGCTCAAACCCGATACAGTCC
CTAAGCTCAAGAAAGCTTTACCAGCTCTGACCGATGGACTTATCGACGATATGATGTCTCCGCCGTGGAGATCTTATGAT
CCTAATCTCATCCAAGAACCAACCATCTACAGGTTGAATGAAGCAGTGATGCATTTTGGTGAGAGTATAAAGGAGATTAT
CAATGAAGATTTTGGTGACGGCATCATGTCAGCGATAGACTTCTATTGCTCTGTAGACAAAATTAAAGGAGCGGATGGTA
ACAATCGTGTGGTTGTGACACTTGATGGGAAGTATCTTTCGCATTCCGAACAGAGGACGGAGAATATGGTGTCAAGGCTA
AACCTCAAGGGAAGTACAAGCGAATGA