Details for Capsella Locus Carubv10014784m

Position : scaf_3 ( 5`- 5284933 .. 5286579 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014784m

Protein [Map View]
MELDPKKFAQLLEKIEAEADEFLLARNQMVENDKERNANREALTALRKRARTTKTSVLSPFDSMMKDIHSSSSKPLVQEV
CSTCGSHDSSEPTWMMLPGADLFAAVPFHAVHTMLEKDEEKLEFESKKLQSLVKEKALFISELGALADNTSPGVIRSLVA
LKDNKPLVN*

DNA
ATGGAGTTGGATCCAAAGAAGTTTGCTCAACTATTGGAAAAAATTGAAGCTGAAGCTGATGAGTTCCTACTAGCTCGAAA
TCAGATGGTGGAGAATGACAAGGAGAGGAATGCAAACCGAGAGGCTCTTACAGCACTTAGGAAGAGAGCTCGGACAACTA
AGACTAGTGTTCTTTCTCCATTCGATTCCATGATGAAGGATATACATAGTAGCTCAAGCAAACCTTTGGTCCAAGAAGTT
TGCTCTACGTGTGGATCCCATGACTCTAGTGAACCCACTTGGATGATGCTACCAGGAGCTGATCTATTTGCTGCAGTTCC
CTTCCATGCTGTGCATACAATGCTAGAGAAAGATGAAGAGAAACTGGAGTTTGAATCGAAGAAGTTGCAGAGCTTAGTGA
AGGAGAAGGCACTTTTTATATCGGAACTAGGTGCTCTTGCTGATAATACGTCCCCAGGCGTTATCAGATCGTTGGTGGCG
TTAAAGGACAACAAACCTTTAGTTAACTAG