Details for Capsella Locus Carubv10014783m

Position : scaf_3 ( 5`- 5438853 .. 5441099 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014783m

Protein [Map View]
MAASLSSRLMKGIASLQAVRSSRLTSASAYQNGMMRYSSTVPSDSDTHDDFKPTQKVPADSTDSLKDIVENDVKDNAVMI
YMKGVPEAPQCGFSSLAVRVLQQYNVPISSRNILEDPELKNAVKSFSHWPTFPQIFIKGEFIGGSDIILNMHKEGELEQK
LKDVSGNQE*

DNA
ATGGCAGCTTCTTTATCGAGCAGACTTATGAAAGGAATCGCTAGCCTCCAGGCTGTTCGTTCTAGCAGATTGACATCTGC
ATCAGCCTACCAAAATGGGATGATGAGATACTCATCTACAGTGCCAAGTGATTCAGACACACATGATGATTTCAAGCCTA
CACAAAAAGTCCCTGCGGATTCTACGGACTCACTCAAAGATATCGTTGAGAATGATGTGAAGGATAACGCTGTGATGATT
TACATGAAAGGTGTCCCTGAAGCTCCTCAGTGTGGGTTTAGCTCACTAGCCGTCAGAGTTTTGCAACAATACAATGTTCC
TATCAGTTCTAGAAACATTCTAGAAGACCCAGAGTTGAAAAACGCTGTGAAATCCTTCAGCCACTGGCCGACGTTTCCAC
AGATCTTCATTAAGGGAGAGTTCATTGGTGGCTCAGACATCATTCTTAACATGCACAAGGAAGGTGAATTGGAGCAGAAG
CTTAAAGACGTGTCCGGAAACCAAGAGTGA