Details for Capsella Locus Carubv10014782m

Position : scaf_3 ( 5`- 2755147 .. 2756582 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014782m

Protein [Map View]
MDQILNKVGSYWLGKKANKQLDSVGDDINSLSTSIEGGTKWLVNKIKGKMQKPLPELLKEFGLPVGIFPRDATNYEFNEQ
TRKLTVFIPSICEVGYKDSSVLRFTTTVTAFLEKGKLADVEGMKTKVMIWVKVTSISADSSKVHFMAGMKKSRSRDAYEV
LRDGVEIDKF*

DNA
ATGGATCAGATCTTGAACAAGGTAGGCTCGTACTGGTTAGGTAAGAAGGCGAACAAGCAGCTCGATTCCGTCGGTGACGA
TATCAACTCTCTCTCGACGAGTATTGAAGGAGGAACAAAATGGCTGGTGAACAAAATCAAAGGAAAAATGCAGAAGCCAT
TGCCCGAGTTACTTAAGGAGTTTGGTTTGCCTGTTGGAATCTTTCCACGTGACGCAACCAACTACGAGTTCAATGAACAG
ACGAGGAAACTAACCGTCTTTATTCCATCAATCTGTGAAGTTGGCTACAAAGATTCATCAGTCTTGAGATTCACCACTAC
AGTTACCGCTTTTCTCGAGAAAGGAAAGCTAGCCGATGTTGAAGGGATGAAGACAAAAGTAATGATATGGGTTAAAGTCA
CAAGTATTTCTGCTGATTCTTCAAAGGTACATTTCATGGCTGGGATGAAGAAAAGCAGAAGCCGAGATGCTTATGAGGTT
CTAAGAGATGGCGTTGAGATTGATAAATTCTAG