Details for Capsella Locus Carubv10014780m

Position : scaf_3 ( 5`- 2415890 .. 2417599 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014780m

Protein [Map View]
MLRIIQIALLCLVLAAGISISAVIAENESIDEILQANGLPLGIFPKGVKGFSVNGETGRFSVYLNQSCQAKYETELHYDA
NISGTIGYAQIGDLSGISAQELFLWFPVKGIRVDVPSSGLIFFDVGVVHKQYSLALFETPRDCVAVRGENKVQSSMLPLY
HIDQTLGRDIV*

DNA
ATGCTTCGTATCATCCAAATCGCGCTTCTTTGCCTCGTTCTCGCCGCCGGGATCTCGATCTCCGCCGTGATCGCGGAGAA
CGAATCTATAGACGAGATCCTTCAGGCGAACGGATTGCCTTTGGGGATATTCCCGAAAGGGGTGAAAGGGTTCAGCGTTA
ATGGCGAAACGGGACGCTTCTCGGTTTATCTGAATCAGTCGTGTCAGGCTAAGTACGAGACCGAGCTGCATTACGACGCG
AATATTTCGGGGACGATAGGTTACGCACAAATCGGGGATTTATCGGGAATCTCGGCGCAAGAGCTGTTCTTGTGGTTTCC
GGTTAAAGGAATCCGTGTTGACGTGCCGAGCTCTGGTCTCATATTCTTTGATGTTGGTGTTGTTCACAAGCAATATTCTT
TGGCTCTGTTCGAGACACCCAGAGATTGTGTTGCCGTTCGTGGTGAAAACAAGGTTCAGTCATCTATGTTGCCATTGTAT
CATATAGATCAAACTCTTGGGAGAGACATTGTTTAG