Details for Capsella Locus Carubv10014777m

Position : scaf_3 ( 5`- 2553043 .. 2554684 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014777m

Protein [Map View]
MECGGDSVVGVGDYLVETKREKLKSVLSHLLADPILADVPRNPTLSDVVTLVSLEKGSAMRLSVVKLDGSSLDVAVMNSA
TLKDLKLLIKNKVNETEQANMGHRHISWKHVWSNFCLSYNNEKLLDDNALLQDVGIRNNSQVTFMPYVMKKGRGRHSKRK
KHRLFRSLHKTC*

DNA
ATGGAGTGCGGCGGCGATAGCGTTGTCGGAGTTGGAGATTACTTGGTTGAGACGAAGAGAGAGAAGCTTAAATCGGTTCT
TTCTCATCTCCTTGCCGATCCGATTCTCGCCGACGTTCCGAGGAACCCAACACTTTCTGATGTCGTCACTCTTGTCAGTC
TCGAAAAGGGAAGCGCTATGCGTCTCTCCGTCGTCAAGCTCGACGGCTCCTCACTGGATGTCGCCGTCATGAATTCAGCT
ACTCTGAAAGATCTGAAGCTTTTGATCAAGAATAAAGTTAACGAAACGGAGCAAGCAAACATGGGCCATCGCCACATTTC
TTGGAAACATGTATGGTCAAACTTTTGTCTTTCGTACAATAATGAGAAGCTGCTTGACGACAATGCTCTTCTTCAAGATG
TCGGAATCCGGAACAATTCTCAGGTGACCTTTATGCCATATGTGATGAAGAAGGGTCGAGGAAGACATTCCAAGAGGAAG
AAGCATCGTCTCTTTCGTTCCCTACACAAGACTTGTTAA