Details for Capsella Locus Carubv10014772m

Position : scaf_3 ( 5`- 8411619 .. 8412922 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014772m

Protein [Map View]
MAYEKVNELNLKDTELCLGLPGRTEEIKQEQEVSCVRSNNKRQFEETLDDEESTPPTKTQIVGWPPVRSYRKNNSVSYVK
VSMDGAPYLRKIDLKTYKNYPELLKALENMFKFTVGEYSEREGYKGSGFVPTYEDKDGDWMLVGDVPWDMFSSSCKRLRI
MKGSDAPALDSSSL*

DNA
ATGGCGTACGAGAAAGTCAACGAGCTTAACCTTAAGGATACAGAGCTATGTCTTGGATTACCAGGAAGAACAGAGGAAAT
CAAACAAGAACAAGAGGTTTCTTGTGTTAGAAGCAACAACAAGCGTCAATTTGAGGAAACTCTTGATGATGAAGAATCTA
CACCTCCTACGAAAACTCAAATCGTTGGATGGCCACCAGTGAGATCTTACCGTAAGAACAACAGCGTAAGCTACGTTAAA
GTGAGTATGGACGGAGCTCCTTACCTCCGCAAGATCGATCTAAAGACATACAAAAACTACCCTGAGCTTCTCAAGGCGTT
AGAGAACATGTTCAAGTTCACGGTTGGTGAATACTCTGAGAGAGAAGGATACAAAGGATCTGGATTTGTACCAACATACG
AAGACAAAGATGGAGATTGGATGTTGGTCGGTGATGTTCCATGGGATATGTTCTCTTCTTCATGTAAAAGACTCAGAATC
ATGAAAGGATCCGATGCTCCTGCTCTAGACTCTTCTTCCTTATGA