Details for Capsella Locus Carubv10014769m

Position : scaf_3 ( 5`- 4062729 .. 4063261 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014769m

Protein [Map View]
MEGGDTKRQKTTVHMEKVENKETSESGSVDFAELRDDLFREAAKLVSDVPSTKIAIFLTRPPSESMDSFGYPSVNGVVKT
FLEDNSSDPAPADDAEEDSENEEEEEEEEDDASSSQTQRFWWEDAKQFESMNPEELEAAYDTLARLSHELDARLRSQGSG
SQQHLLGNDRAQPKP*

DNA
ATGGAAGGAGGAGATACCAAGAGGCAGAAGACGACGGTTCACATGGAGAAGGTAGAGAACAAGGAAACATCTGAATCAGG
ATCAGTCGATTTCGCAGAACTACGTGACGATCTCTTCCGTGAAGCAGCAAAACTTGTCTCCGACGTTCCCTCCACCAAAA
TCGCCATCTTCCTTACCCGTCCTCCTTCCGAATCTATGGACTCCTTCGGCTACCCTTCTGTCAATGGCGTTGTTAAAACT
TTCCTCGAGGATAACTCTTCCGACCCAGCACCAGCGGATGACGCAGAGGAGGATTCCGAGAATGAAGAGGAAGAGGAAGA
GGAAGAGGATGATGCCTCTTCGTCTCAAACTCAGAGGTTTTGGTGGGAAGATGCTAAGCAATTCGAATCAATGAATCCGG
AGGAGTTGGAGGCTGCGTATGATACGTTGGCGAGGCTAAGTCACGAACTCGACGCCAGATTGCGATCTCAAGGTTCTGGT
AGTCAGCAGCATCTTCTTGGTAACGACAGAGCTCAACCCAAGCCCTAA