Details for Capsella Locus Carubv10014767m

Position : scaf_3 ( 5`- 7826048 .. 7828246 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014767m

Protein [Map View]
MDEVMTATDAGSLGGGNRALYGSPPSSHNLFPHNLPIFSAFLAFALAQFLKVFTNWYKEKRWDSKRMISSGGMPSSHSAT
VTALAVAIGLEEGAGAPAFAIAVVLACVVMYDASGVRLHAGRQAELLNQIVCEFPPEHPLSTVRPLRELLGHTPIQVAAG
GVLGCVVAYLMRSTS*

DNA
ATGGACGAGGTGATGACAGCGACGGACGCGGGTTCTTTAGGAGGCGGAAACAGGGCGTTGTATGGATCACCTCCGTCGTC
GCATAATCTGTTTCCTCACAATCTCCCAATCTTCTCTGCTTTTCTTGCCTTCGCTCTTGCTCAGTTCCTCAAAGTTTTCA
CTAATTGGTACAAAGAAAAGAGGTGGGACTCTAAACGGATGATTAGTTCTGGTGGAATGCCTTCCTCTCACTCAGCTACC
GTCACTGCCTTAGCTGTTGCCATTGGCCTAGAAGAAGGAGCTGGAGCACCCGCTTTTGCTATTGCGGTTGTGTTAGCCTG
TGTTGTGATGTATGATGCATCCGGGGTTAGGCTTCATGCTGGTCGTCAAGCCGAGCTGCTGAATCAAATTGTTTGTGAGT
TTCCCCCCGAGCATCCCTTATCCACAGTTAGACCCTTGCGTGAACTGCTCGGCCACACTCCTATCCAGGTTGCAGCAGGT
GGGGTTTTAGGATGTGTGGTAGCTTATTTGATGAGGAGCACAAGCTAG