Details for Capsella Locus Carubv10014764m

Position : scaf_3 ( 5`- 5343701 .. 5345443 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014764m

Protein [Map View]
MASKLVVIIVFILDLIAVGLAIAAEQRRSVGKVETDREKQFEYCVYGTDIATSYGAGAFVLLFVSQVLIMAASRCFCCGK
SLNPGGSRACAIMLFLLCWVFFLIAEVCLLAASIRNAYHTQYRKMWNIDNPPSCEVIRKGVFAAGAAFTLFTAIVSQFYY
VCYSRAKDAYQNPSY*

DNA
ATGGCGTCGAAGCTTGTAGTTATAATCGTCTTCATCCTCGATCTCATCGCCGTTGGGTTAGCCATTGCCGCCGAGCAGAG
AAGAAGTGTCGGCAAGGTTGAAACGGACAGGGAGAAGCAGTTTGAGTACTGTGTTTATGGCACAGACATTGCTACAAGCT
ATGGAGCTGGTGCGTTTGTTCTTCTCTTTGTAAGCCAAGTCCTTATCATGGCGGCTAGTCGTTGCTTCTGCTGTGGAAAG
TCCCTTAACCCTGGTGGTTCAAGAGCTTGTGCCATTATGCTCTTCCTCCTTTGCTGGGTGTTTTTCTTGATCGCTGAGGT
ATGTTTGCTTGCGGCATCAATCAGAAACGCATACCACACACAGTATAGAAAGATGTGGAACATTGACAATCCACCAAGCT
GTGAAGTTATAAGGAAAGGAGTCTTTGCAGCTGGTGCTGCATTCACCCTCTTCACAGCCATTGTCTCTCAGTTCTACTAC
GTTTGCTACTCTCGTGCTAAAGATGCTTACCAGAATCCGTCCTACTGA