Details for Capsella Locus Carubv10014763m

Position : scaf_3 ( 5`- 5430315 .. 5432838 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014763m

Protein [Map View]
MWRRIVSSHLKTLAADVVAASSRRSIAATARPVGFYLSANRSAISASSSVFSRHFSSESVEISAKKKVEDVMPIATGHEK
EELEAEMEGRRLLDIDFPEGPFGTKEAPAVVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKSFECPVCTQYFELEVVGP
GGPPDGHGDEEHEHHH*

DNA
ATGTGGAGAAGAATCGTCTCCTCTCATCTCAAAACCCTAGCCGCCGATGTTGTCGCTGCTTCTTCTCGTCGATCGATAGC
CGCCACCGCTAGACCCGTCGGCTTCTATCTCTCCGCCAATCGATCAGCCATTTCTGCTTCTTCTTCTGTTTTCTCTCGAC
ATTTCAGCTCCGAATCAGTAGAGATTTCCGCGAAGAAGAAGGTGGAGGATGTAATGCCTATTGCAACTGGTCATGAGAAG
GAAGAGCTTGAAGCTGAAATGGAGGGAAGGAGGCTGCTTGATATTGACTTCCCTGAAGGTCCTTTTGGCACAAAGGAAGC
TCCTGCTGTTGTGAAGTCCTACTATGACAAGCGAATTGTGGGATGCCCTGGTGGTGAAGGCGAGGATGAGCACGATGTTG
TGTGGTTCTGGCTGGAGAAAGGAAAGTCCTTTGAGTGCCCAGTTTGCACGCAGTACTTTGAGCTGGAAGTGGTTGGTCCT
GGTGGACCTCCGGATGGTCACGGTGATGAAGAACATGAGCACCACCACTAA