Details for Capsella Locus Carubv10014761m

Position : scaf_3 ( 5`- 2121830 .. 2122479 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014761m

Protein [Map View]
MGRRKIKMEEVQDTNTKQVTFSKRRLGLFKKASELATLCNAEVGIVVFSPGNKPYSFGKPNFDLIAERFKSEFEETDSFE
TSSGYRRGSRARQEKKICKRLNSVVEDAEAEKKHGEDLHNWLESAEEDRFNKPIDEFTLEELKEFEAKMKRLRGGIQSNI
DHMQASSSLLFLSNDD*

DNA
ATGGGTCGGAGAAAGATAAAGATGGAGGAAGTGCAAGACACAAACACAAAGCAAGTAACCTTCTCGAAACGTAGACTGGG
TTTGTTCAAGAAAGCGAGTGAGCTTGCGACTCTGTGCAACGCCGAGGTTGGTATTGTTGTCTTTTCTCCAGGAAACAAAC
CTTACTCCTTCGGGAAACCGAATTTTGATTTGATTGCAGAACGGTTTAAGAGTGAGTTCGAAGAGACAGATAGCTTTGAA
ACATCATCAGGCTATAGAAGAGGCAGTCGTGCTAGACAAGAGAAGAAGATATGTAAACGCCTCAACTCCGTCGTCGAGGA
CGCTGAAGCTGAGAAGAAACATGGCGAAGACCTTCACAACTGGCTTGAATCTGCTGAAGAAGACAGGTTTAACAAGCCCA
TTGATGAGTTTACTCTCGAGGAGCTCAAGGAATTTGAAGCCAAGATGAAGAGATTGAGAGGTGGGATTCAAAGTAACATT
GATCACATGCAGGCTTCGTCTTCTCTCTTGTTTCTCTCTAATGATGATTAG