Details for Capsella Locus Carubv10014759m

Position : scaf_3 ( 5`- 1319457 .. 1321407 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014759m

Protein [Map View]
MSAESASQIPKGQVDLLDFIDWSGVECLNQSSSHSLPNALKQGYREDEGLNLESDADEQLLIYIPFNQVIKLHSFAIKGP
EEEGPKTVKFFSNKEHMCFSNVNDFPPSDTAELTEENLKGKPVVLKYVKFQNVRSLTIFIEDNQSGSEVTKVQKIALYGS
TVETTDMKGLKKIEDH*

DNA
ATGTCCGCCGAATCAGCTAGCCAAATCCCTAAGGGACAGGTTGATCTGCTAGATTTTATTGACTGGTCTGGTGTTGAATG
CCTGAACCAAAGCTCAAGTCACTCTCTGCCCAATGCTCTCAAACAGGGATATAGAGAAGATGAAGGTTTGAACTTAGAGA
GTGATGCTGACGAGCAGCTTCTGATCTATATTCCTTTTAACCAAGTTATCAAACTACATTCCTTTGCTATCAAAGGCCCT
GAAGAGGAAGGTCCTAAAACTGTAAAGTTTTTCTCAAACAAAGAGCACATGTGCTTCAGCAATGTCAATGATTTTCCTCC
AAGCGACACTGCTGAACTAACTGAAGAAAACCTTAAGGGGAAACCGGTTGTCCTTAAATATGTTAAGTTTCAGAATGTTC
GTAGCTTGACGATCTTCATTGAAGACAACCAATCGGGTTCTGAGGTCACAAAGGTTCAGAAGATTGCTCTCTATGGTTCA
ACGGTGGAGACGACTGATATGAAGGGATTGAAAAAGATTGAAGATCACTGA