Details for Capsella Locus Carubv10014757m

Position : scaf_3 ( 5`- 4882422 .. 4883355 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014757m

Protein [Map View]
VFQVLETYKPNILSKKKRFKVSSVREKKRNTKGYNMAYSTKLCLPLRTPCLAPKTVRSKTVMILQQSQVQVQVKHVTVSQ
PQPIRYSTKNTVFEDPTQGIICYTDDNGEVICEGYDEGPRCPTQSPMVASYSREVEILDLLQRSYQELRGAEKDGQTQMI
ASQPELKMIEWSSFDFL*

DNA
GTTTTTCAAGTTCTTGAGACCTATAAACCAAACATTTTGTCCAAAAAGAAGAGATTCAAAGTTTCTTCAGTAAGAGAAAA
GAAAAGAAACACAAAGGGCTATAATATGGCCTATTCAACTAAACTTTGTCTTCCTCTTAGAACACCATGTTTAGCTCCAA
AAACAGTGAGATCAAAGACTGTGATGATTCTTCAACAGAGTCAAGTTCAAGTTCAAGTCAAACATGTCACAGTTTCGCAG
CCTCAGCCGATCAGATACTCCACCAAGAACACTGTCTTTGAAGATCCGACGCAAGGGATCATATGTTACACAGATGATAA
TGGAGAGGTTATATGTGAAGGATACGATGAAGGTCCTCGTTGTCCCACACAGAGTCCAATGGTAGCTTCTTACTCAAGAG
AGGTAGAGATTCTTGATCTCCTGCAAAGAAGTTATCAAGAACTGAGGGGTGCTGAGAAAGATGGTCAAACACAGATGATT
GCTTCACAACCAGAGTTAAAGATGATCGAATGGAGCAGCTTTGACTTTCTCTAA