Details for Capsella Locus Carubv10014756m

Position : scaf_3 ( 5`- 5028053 .. 5029499 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014756m

Protein [Map View]
MGAFRFHQYQVVGRALPTEKDEHPKIYRMKLWGTNEVCAKSKFWYFMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIW
LRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRP
PSRKLKTTYKASKPNLFM*

DNA
ATGGGTGCTTTCCGGTTTCACCAGTATCAAGTGGTTGGGAGAGCTCTTCCGACAGAGAAAGATGAGCACCCTAAGATCTA
CAGGATGAAGCTATGGGGCACAAATGAAGTATGCGCCAAGTCCAAGTTTTGGTACTTCATGAGGAAACTGAAGAAGGTGA
AGAAAAGCAACGGGCAGATGCTTGCCATCAATGAGATTTTCGAGAAGAACCCGACGACGATCAAGAATTATGGTATCTGG
CTGCGTTATCAGAGCCGAACTGGGTACCATAACATGTACAAGGAGTACCGTGACACAACACTCAATGGTGCAGTGGAGCA
GATGTACACTGAGATGGCTTCTCGTCATAGAGTGAGGTTCCCATGCATTCAGATCATAAAGACTGCAACAGTCCCTGCAA
AGCTGTGCAAGAGAGAGAGCACCAAACAGTTCCACAACTCCAAGATCAAGTTCCCTCTTGTTTTCAGAAAGGTCAGACCA
CCAAGCAGGAAGCTCAAGACTACATACAAGGCATCAAAGCCCAACCTCTTCATGTAA