Details for Capsella Locus Carubv10014755m

Position : scaf_3 ( 5`- 3105040 .. 3107310 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014755m

Protein [Map View]
MKEMQAIETSQPTTVAPAVHSRQLGAQLSGSMSFSSQMSKEDEEMSRTALSAFRAKEEEIEKKKMEIRERVQAQLGRVEE
ETKRLALIREELEGLADPMRKEVALVRKKIDSVNKELKPLGHTVQKKEREYKEALEAFNDKNREKVQLITKLMELVGESE
KMRMKKLEELSKNIDSIH*

DNA
ATGAAGGAGATGCAAGCAATAGAGACGTCGCAGCCGACGACGGTGGCTCCGGCGGTGCATAGCCGACAGTTGGGAGCTCA
GTTGTCGGGAAGTATGAGTTTCAGCAGCCAAATGTCCAAGGAAGACGAGGAGATGTCTAGGACTGCGTTGTCTGCCTTCA
GGGCCAAAGAAGAAGAGATCGAGAAGAAGAAAATGGAGATTAGGGAAAGGGTTCAAGCCCAGCTTGGTCGTGTTGAAGAA
GAGACTAAGCGTCTTGCTTTGATCCGTGAGGAACTTGAAGGTTTAGCTGATCCCATGAGGAAAGAAGTTGCTTTGGTCAG
GAAGAAGATTGATTCTGTCAACAAAGAATTAAAGCCATTGGGCCATACGGTTCAGAAAAAGGAACGAGAGTACAAAGAAG
CTCTTGAAGCATTCAACGATAAGAATAGGGAGAAGGTGCAGCTTATCACCAAGCTAATGGAGTTGGTGGGAGAAAGCGAA
AAGATGAGAATGAAGAAGCTGGAAGAGCTGAGCAAGAACATAGATTCCATACACTGA