Details for Capsella Locus Carubv10014749m

Position : scaf_3 ( 5`- 4100786 .. 4102585 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014749m

Protein [Map View]
MCDLVARTGRLQQRYEDGSRLVAGCIPFRYINSEEDGNSDTGKVIQVLMISSSSGPGLLFPKGGWENDETVREAAVREAV
EEAGVRGDLMDFLGNYEFKSKTHQDEFSPEGLCKAAMYALRVKEELEMWPEQKTRTRTWLTIEEAVESCRHAWMKDALVE
GFCKWHKEKMEKGEITDEDLK*

DNA
ATGTGTGATTTGGTCGCGCGTACGGGTCGACTCCAGCAGCGTTACGAGGATGGCTCTCGTCTCGTAGCCGGGTGTATTCC
GTTTAGGTACATTAACTCTGAAGAAGATGGTAATTCTGATACTGGGAAAGTGATTCAAGTGTTGATGATCAGCTCATCTA
GTGGACCGGGACTTTTGTTCCCCAAGGGAGGATGGGAAAATGATGAAACAGTCAGGGAGGCTGCAGTGAGGGAAGCTGTA
GAAGAAGCAGGAGTCCGTGGGGATCTTATGGATTTTTTAGGAAATTATGAGTTCAAGAGCAAAACGCACCAAGATGAGTT
TAGCCCAGAAGGCTTATGTAAAGCGGCTATGTACGCTTTGCGTGTGAAGGAAGAGCTAGAGATGTGGCCTGAACAGAAGA
CGAGAACACGGACTTGGCTGACAATTGAAGAAGCGGTAGAGAGTTGCAGGCACGCATGGATGAAGGACGCGTTGGTGGAA
GGTTTCTGTAAATGGCATAAGGAGAAGATGGAAAAAGGAGAGATAACAGATGAAGATTTGAAGTAA