Details for Capsella Locus Carubv10014745m

Position : scaf_3 ( 5`- 2162900 .. 2164737 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014745m

Protein [Map View]
MALIQSRTLPQLNIPLSPILSSLHAPSSLVLRREIRAAASPFYSSSARNFPISPLTPSRKLLCPPPRGKFVREDYLVKKL
SAQELQEMVKGDRTVPLIVDFYATWCGPCILMAQELEMLAVEYESNAVIVKVDTDDEYEFARDMQVRGLPTLLFISPDPS
KDAIRTEGLIPLQMMRDIIDNEM*

DNA
ATGGCTCTTATTCAATCCAGAACTCTTCCACAGCTCAATATCCCGTTGTCGCCGATTCTATCCTCTCTTCATGCTCCGTC
GTCTCTCGTTCTCCGCAGGGAAATCCGAGCTGCAGCCTCGCCGTTCTACTCCTCCTCCGCCAGGAACTTTCCCATATCGC
CGCTGACGCCCTCACGGAAGCTTCTCTGTCCTCCACCTCGAGGCAAGTTTGTTAGAGAAGATTATCTTGTGAAGAAATTG
TCAGCTCAAGAACTTCAAGAAATGGTGAAAGGGGATAGGACGGTGCCCTTGATTGTAGATTTTTATGCGACATGGTGTGG
ACCTTGTATCTTGATGGCCCAGGAACTAGAAATGCTCGCAGTAGAGTATGAGAGCAATGCAGTAATTGTGAAAGTCGATA
CAGATGATGAGTACGAGTTTGCACGCGACATGCAGGTTAGGGGCTTACCTACATTATTGTTCATCAGTCCTGACCCAAGC
AAAGATGCGATAAGGACAGAAGGACTGATTCCATTACAGATGATGCGCGATATCATTGACAACGAGATGTGA