Details for Capsella Locus Carubv10014744m

Position : scaf_3 ( 5`- 2317583 .. 2319577 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014744m

Protein [Map View]
MTSRVVRTNMRLRRRDGGNGTQSEHQGDQQGTEQAPTVMPQIVSWPPMIDIDAIEDDDDVVESTASAFAQAKNKSRGARR
GLVVVDVDSGGTTRSTRRRSDQSADSVELNKPRKSKAVAPVEEPKFNCPICLCPFTEEVSTKCGHIFCKECIKNAISVQA
KCPTCRKKVSAKDLIRVFLPTTR*

DNA
ATGACTTCTCGGGTGGTGAGGACAAATATGAGACTTCGAAGAAGGGATGGTGGGAATGGGACTCAAAGTGAACACCAGGG
AGATCAACAAGGGACTGAACAAGCTCCAACTGTGATGCCGCAGATTGTGTCTTGGCCTCCTATGATCGATATAGATGCCA
TTGAAGATGATGATGATGTTGTTGAATCAACTGCATCTGCTTTTGCTCAGGCTAAAAACAAATCAAGAGGTGCGCGCAGA
GGACTCGTAGTAGTTGATGTAGACTCAGGTGGGACTACTAGATCCACAAGGCGTCGCTCTGATCAAAGTGCTGACTCGGT
TGAGCTTAACAAGCCGAGAAAGTCCAAGGCCGTGGCTCCTGTAGAGGAACCAAAATTTAACTGTCCAATCTGTTTGTGTC
CATTTACGGAGGAGGTGTCAACGAAGTGTGGTCATATTTTCTGCAAAGAGTGCATAAAGAATGCGATATCTGTCCAAGCT
AAATGCCCGACATGTCGTAAAAAAGTCAGTGCTAAGGACCTTATCCGGGTATTCCTTCCAACCACCAGATGA