Details for Capsella Locus Carubv10014743m

Position : scaf_3 ( 5`- 8359252 .. 8361173 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014743m

Protein [Map View]
MGAFMSRFWFMMFPAKEYKIVVVGLDNAGKTTTLYKLHLGEVVTTHPTVGSNVEELVYKNIRFEVWDLGGQDRLRTSWAT
YYRGTHAVIVVIDSTDRARISFMKDELARILGHEDLQNSVILVFANKQDLKDAMTPAEITDALNLHSIKNHDWHIQASCA
VTGEGLYDGLGWIAQKVTGKATS*

DNA
ATGGGAGCATTCATGTCGAGGTTTTGGTTCATGATGTTTCCTGCAAAAGAGTATAAGATTGTGGTTGTTGGTTTGGATAA
TGCTGGTAAAACAACGACCCTTTATAAACTTCACCTTGGTGAAGTTGTCACTACTCATCCTACTGTCGGTAGCAATGTTG
AAGAGCTTGTCTACAAGAATATCCGCTTTGAGGTCTGGGATCTTGGTGGGCAAGATAGACTAAGGACTTCATGGGCAACA
TACTATCGTGGAACTCATGCTGTGATTGTGGTTATTGATAGCACAGACAGAGCCAGAATCTCTTTCATGAAAGATGAGCT
CGCCAGGATACTTGGTCACGAGGATCTTCAAAACTCGGTCATACTTGTTTTTGCAAACAAACAGGATCTGAAAGATGCGA
TGACTCCTGCTGAGATCACGGATGCACTTAACCTTCACAGTATCAAGAACCATGATTGGCATATTCAAGCAAGTTGTGCG
GTTACTGGAGAAGGGCTATATGATGGGCTCGGTTGGATTGCCCAGAAAGTTACGGGTAAAGCCACGAGTTAA