Details for Capsella Locus Carubv10014731m

Position : scaf_3 ( 5`- 5754332 .. 5757326 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014731m

Protein [Map View]
MFDRKTELFSITGFSKVYQILEVQWILRKGKKLIVVDESRRKLNSRLHSAGHLLDMCMQKVGLGHLEPGKGYHFPDGPFV
EYKGSVSQDKLLVKQKELEAEANELITKGGKVDAAILPYEEASVLCGGSLPDYIPKGSTPRIIKLGDNPGCPCGGTHVSD
ISDIINMKITQMRTKKGMTKVFYTIAS*

DNA
ATGTTCGATCGAAAGACGGAATTGTTCTCCATTACGGGGTTTTCGAAGGTTTATCAAATCCTGGAAGTACAATGGATATT
GAGAAAGGGAAAGAAGTTAATTGTTGTTGATGAATCAAGGCGCAAACTCAATTCCAGGTTGCACTCGGCTGGACACTTGC
TAGATATGTGTATGCAGAAAGTTGGGTTAGGACATTTGGAGCCTGGAAAAGGTTATCACTTTCCAGACGGTCCTTTTGTG
GAATACAAAGGGAGCGTTTCACAGGATAAATTACTGGTGAAGCAGAAAGAGTTGGAGGCAGAAGCTAACGAACTGATAAC
CAAAGGAGGAAAGGTTGATGCTGCTATATTACCCTATGAAGAGGCATCTGTGCTTTGTGGTGGCAGTCTTCCTGATTATA
TTCCTAAGGGCAGCACTCCCCGGATCATAAAATTAGGTGACAACCCCGGGTGTCCTTGTGGTGGGACACATGTCTCCGAT
ATATCTGATATCATAAACATGAAGATCACACAGATGAGAACAAAGAAAGGAATGACGAAAGTTTTCTACACCATTGCATC
TTGA