Details for Capsella Locus Carubv10014729m

Position : scaf_3 ( 5`- 4820978 .. 4822450 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014729m

Protein [Map View]
MATLQQMIFPDENAPIHRKKSVTTAASVKSKRTALGQKKLGGARKALNDITNKSGIPAKASSKNKPIPSAAKDEIDIAGE
GFLHDHSKCIKEQQNMWDDHFSDDLILLHHDSSVKEKHLSFDMEKIDAQNNLTHDEPEEIASPKLTDWLKSSTPWRSPIR
HGSVISSTPLTWRFDSTEFTLTEDSDLF*

DNA
ATGGCGACTCTTCAACAGATGATCTTCCCAGACGAGAACGCTCCGATTCATCGCAAAAAGTCTGTTACTACTGCTGCTTC
TGTGAAATCCAAAAGAACTGCACTTGGTCAGAAGAAACTTGGTGGAGCTCGTAAGGCTCTGAATGATATTACAAACAAGT
CTGGGATTCCTGCTAAAGCTTCCTCAAAGAATAAGCCAATCCCTTCTGCTGCGAAAGATGAAATTGACATAGCTGGGGAA
GGATTCTTACACGATCACAGCAAATGCATCAAAGAGCAGCAAAATATGTGGGATGACCACTTCTCTGATGATCTCATTTT
ACTTCACCATGATTCAAGCGTCAAGGAGAAGCATCTCAGCTTTGACATGGAAAAGATAGATGCTCAGAACAATCTGACTC
ACGACGAACCAGAAGAGATTGCATCTCCTAAGCTGACTGATTGGCTGAAGAGCTCAACTCCATGGCGCTCCCCAATCCGA
CATGGCTCTGTGATTTCATCCACTCCTCTGACTTGGCGGTTCGATTCAACTGAGTTCACACTCACAGAAGACTCTGACCT
CTTCTGA