Details for Capsella Locus Carubv10014726m

Position : scaf_3 ( 5`- 1855842 .. 1857366 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014726m

Protein [Map View]
MKLISLVRNFRSRQCQPKATWSVQVRFLQQDSVSKTKPKKYKYPSVYDPYGPRPQPSNKIVELAERIAALSPEERQQIGP
ALNEHLRLPKQQMISSEGLSLGAKQDAGAGKAEEKKEKTTFDVKLEKFNASDKIKVIKEVRTFTSLGLKEAKELVEKVPA
VLKLGVTKEEANEIIAKIKAVGGVAVME*

DNA
ATGAAGCTTATTTCACTTGTCAGAAATTTTCGTTCTCGCCAATGTCAACCAAAGGCAACCTGGTCTGTGCAAGTGCGTTT
CTTGCAACAAGACTCTGTCTCGAAAACTAAACCCAAGAAATACAAATACCCATCAGTTTATGATCCTTATGGTCCTAGAC
CCCAGCCTTCAAACAAAATCGTGGAGCTAGCTGAGCGTATAGCTGCATTATCTCCAGAAGAACGGCAACAAATTGGTCCT
GCACTCAATGAACACCTGAGGCTTCCGAAACAACAGATGATTTCATCGGAAGGCTTGAGTCTTGGAGCAAAACAAGATGC
CGGAGCCGGGAAAGCAGAGGAGAAGAAGGAGAAGACGACTTTTGATGTGAAGCTGGAGAAGTTTAATGCATCTGATAAGA
TCAAAGTGATAAAAGAAGTGAGAACATTCACGAGTTTGGGTCTAAAGGAGGCAAAAGAGCTTGTCGAGAAAGTCCCGGCT
GTTCTTAAGCTAGGAGTGACAAAGGAAGAAGCTAATGAAATCATAGCGAAGATCAAAGCTGTAGGTGGAGTTGCAGTTAT
GGAGTAA