Details for Capsella Locus Carubv10014706m

Position : scaf_3 ( 5`- 2086261 .. 2089193 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014706m

Protein [Map View]
MKEIQNPRKNFARSSDLGAKRLKDPEMKNRKVAEKRQSAVFSDVSFESTKDPIDFTPISQFSSAISDSEAESVIMQGSSL
ELLSTPEIHLPTDDSAVSTITSVEARTDTSSTDRIQSIVDLPASVQSLRAEINELKKLICSVDTSEEISWVDGIVTVKFR
IVLLSFILWAILAAFVVCFSSGEKVDYNGPLPT*

DNA
ATGAAGGAAATTCAAAATCCCAGGAAAAACTTCGCGCGCTCATCCGATCTCGGAGCTAAGAGACTCAAGGATCCTGAGAT
GAAGAATCGCAAGGTTGCGGAGAAGAGACAGAGCGCAGTCTTTTCCGACGTATCATTTGAAAGCACGAAGGATCCAATCG
ATTTTACTCCGATCTCTCAGTTTTCTAGCGCGATCTCTGATTCCGAGGCTGAGAGTGTTATTATGCAAGGATCGAGCCTA
GAGTTATTGTCAACGCCAGAGATTCATCTTCCCACTGATGATTCTGCAGTTTCAACCATTACTAGTGTGGAGGCTCGTAC
TGATACTTCTTCTACTGATCGGATCCAGTCGATTGTGGACTTGCCTGCTTCTGTGCAGTCCTTGCGTGCAGAGATCAATG
AGCTTAAGAAATTGATCTGTTCAGTTGACACTTCTGAAGAAATTAGCTGGGTCGATGGAATTGTTACTGTGAAATTCCGC
ATTGTGCTTTTGAGTTTCATCCTTTGGGCTATCTTAGCTGCATTTGTGGTCTGCTTCAGCTCAGGGGAGAAAGTTGATTA
CAATGGACCACTTCCAACATGA