Details for Capsella Locus Carubv10014701m

Position : scaf_3 ( 5`- 8062389 .. 8063338 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014701m

Protein [Map View]
MANPNEWSQFYNTNQTYFTTSTTASTAVTTTTTTGDTTSIDSRLSPETGRVTKPTRRRSRASRRTPTTLLNTDTSNFRAM
VQQYTGGPSAMAFGSGNTTSGFSLTSSSDPSAGSSQHVPWQYNFQPHAPLQQPQRPYMFSLNNVNPVVGYSSNNMNNPNT
VVSGMFGTVDGSVGGGSAPSSKEVTNSNTSSSRLQ*

DNA
ATGGCTAACCCCAACGAGTGGTCTCAGTTCTACAACACCAACCAAACCTATTTCACAACTTCCACCACCGCTTCAACCGC
TGTCACAACCACCACCACGACCGGTGACACAACCTCTATAGACTCTCGTCTAAGTCCAGAAACTGGCCGTGTAACCAAGC
CAACACGTAGAAGATCCAGAGCCTCACGTAGAACACCAACAACGCTTCTCAACACCGACACTTCAAACTTCCGTGCCATG
GTTCAGCAATACACTGGTGGTCCATCAGCTATGGCTTTTGGGTCTGGTAACACTACTTCTGGTTTCAGCCTCACTTCTTC
CTCTGATCCATCCGCTGGATCTTCTCAACATGTTCCTTGGCAATATAATTTCCAGCCTCACGCGCCGCTGCAGCAGCCTC
AACGGCCTTATATGTTTTCTTTGAACAACGTGAACCCCGTGGTCGGGTATAGTAGTAATAACATGAACAACCCTAACACG
GTTGTTTCGGGTATGTTTGGGACGGTGGATGGTTCTGTTGGAGGAGGCTCAGCTCCGTCGTCTAAGGAGGTTACGAATAG
TAACACTTCTTCTTCGAGGTTGCAATGA