Details for Capsella Locus Carubv10014697m

Position : scaf_3 ( 5`- 6514611 .. 6515559 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014697m

Protein [Map View]
MERSTPEHVTSAHKRLSMNFLVSLMVLCARHASRVSKKLKPKMTRKQTYLEDYLETPKANGKGGEVGGGGGRFGWSPARS
FSPMRARSKELMTTLSNKAMTMVGRKNKPYDGGAVKKTPVEMVMEEDEEEYGVWQREILMGGKCEPLDYSGVIYYDCSGH
QLKEVPPRSPRASLVPERPTRSYVGSLLNPTGKEI*

DNA
ATGGAAAGATCAACACCGGAACATGTCACCTCCGCACACAAGCGCCTAAGCATGAACTTCCTCGTCTCTCTCATGGTACT
TTGTGCTAGACACGCAAGCCGAGTCTCCAAGAAGCTTAAACCCAAGATGACTCGGAAGCAAACTTATCTCGAAGACTATC
TCGAAACCCCTAAGGCTAACGGGAAGGGTGGCGAAGTAGGCGGAGGAGGAGGAAGGTTTGGATGGAGTCCCGCAAGGTCT
TTCTCACCGATGAGGGCGCGTTCGAAGGAGCTCATGACGACCTTGAGCAACAAGGCGATGACTATGGTTGGTCGGAAAAA
TAAACCTTACGACGGTGGTGCTGTGAAGAAGACACCAGTGGAGATGGTGATGGAGGAGGATGAGGAGGAGTACGGCGTTT
GGCAGAGGGAGATTTTGATGGGAGGAAAATGTGAGCCGTTGGATTACTCCGGCGTGATATACTACGATTGTAGTGGACAT
CAGCTAAAAGAAGTGCCTCCAAGGTCGCCACGTGCTAGTTTGGTCCCGGAACGCCCTACCCGTTCTTATGTCGGGTCACT
ATTAAACCCGACGGGAAAAGAAATTTAA