Details for Capsella Locus Carubv10014689m

Position : scaf_3 ( 5`- 5398776 .. 5401220 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014689m

Protein [Map View]
MEKEGLGLEITELRLGLPGRDVAEKMMKKRAFTEMIMTSSGSNSEQCESGVVSSGGDVEKVNDSPAAKSQVVGWPPVCSY
RRKNSCKDASAAKVGLGYVKVSMDGVPYLRKMDLGSSQGYDDLAFALDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDWM
LAGDVPWGMFIESCKRLRIMKRSDATGFGLQPRGVDE*

DNA
ATGGAGAAAGAAGGTCTCGGGCTTGAGATAACGGAGTTGAGGTTGGGTCTCCCGGGGAGAGATGTTGCGGAGAAGATGAT
GAAGAAGAGAGCTTTCACGGAGATGATCATGACGTCTTCGGGTAGTAACAGTGAACAATGTGAAAGCGGTGTCGTTTCTT
CCGGCGGTGACGTTGAGAAAGTCAATGATTCGCCGGCGGCGAAAAGTCAGGTGGTGGGGTGGCCGCCGGTTTGCTCCTAC
CGGAGGAAAAACAGCTGCAAGGATGCTTCGGCGGCGAAAGTTGGGTTAGGGTATGTGAAAGTGAGCATGGATGGTGTGCC
TTACTTGAGGAAGATGGATCTTGGTTCAAGCCAAGGTTACGATGATCTAGCCTTTGCTCTTGATAAGCTCTTCGGCTTCC
GTGGCATCGGCGTGGCCTTGAAAGATGGTGATAACTGCGAATACGTTACCATATACGAAGACAAAGATGGAGACTGGATG
CTTGCCGGAGATGTACCTTGGGGGATGTTCATAGAGTCATGCAAGAGGTTGAGGATAATGAAAAGATCGGATGCTACCGG
GTTTGGGCTGCAGCCTAGAGGAGTAGACGAGTGA