Details for Capsella Locus Carubv10014684m

Position : scaf_3 ( 5`- 6813045 .. 6815525 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014684m

Protein [Map View]
MAAPAKNLSSQMFRLYPYRSLPSHRPLVYLPRLPSRSLRCRATADIPLGDGIRLPRESDSTSDAARSRDVSVSAGGNGEG
AKWRKRRLLWSKSGVSYLVGDDDALPLPMTYPDTSPVSPDVIDRRLQCDPVVEDCKEVIYEWTGKCRSCQGSGSVSYYKK
RGKEVICKCIPCQGIGYVQKITSRTDIDVMEDLDKETS*

DNA
ATGGCCGCACCTGCAAAAAACTTGTCGTCTCAAATGTTCCGATTATACCCTTATCGCTCTCTACCCTCTCACAGACCTCT
CGTTTACCTTCCTCGCCTTCCTTCTCGCTCCCTCCGTTGCCGTGCCACCGCAGATATCCCCCTTGGCGACGGAATCCGAT
TACCTCGGGAATCGGATTCTACCTCTGACGCGGCGAGGTCTCGGGATGTTTCCGTCTCCGCCGGTGGGAATGGTGAAGGA
GCTAAGTGGAGGAAGAGGAGGTTGCTCTGGTCGAAAAGTGGAGTGAGTTACTTGGTAGGTGACGACGACGCGCTTCCTCT
TCCTATGACTTATCCTGATACATCACCTGTGTCGCCTGATGTGATTGACCGGAGGTTGCAATGTGATCCTGTAGTCGAGG
ATTGCAAGGAAGTAATTTATGAATGGACTGGCAAGTGTAGAAGTTGCCAAGGGTCTGGATCTGTCAGCTATTACAAGAAA
AGGGGTAAAGAAGTTATATGCAAATGCATACCCTGCCAAGGGATTGGATATGTGCAGAAAATAACATCTCGGACGGACAT
TGATGTTATGGAAGATTTAGATAAGGAAACATCTTGA