Details for Capsella Locus Carubv10014646m

Position : scaf_3 ( 5`- 6769805 .. 6771172 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014646m

Protein [Map View]
MSERKRELEEEEDSNTRVSSPLKKRKLDDASDSSSDSHHEDNDVVFVAASSSSSSSHSVDSSAALASDECSATSTAEEND
QSSSSISSGCCFTNQSKEIAKNRSTFVTDLEAHQISETETKTSTLINSNFRRETSPVSEGLGETTTEMESSSAAEVRKTP
TPAEIEGFFSELENEADDKKKQFIEKYNFDIVNDEPLQGRYKWDRL*

DNA
ATGAGCGAGAGAAAGCGAGAGCTTGAAGAAGAAGAAGATTCAAACACAAGAGTATCATCACCTCTGAAGAAAAGGAAGCT
CGATGACGCTTCTGATTCATCATCGGACTCTCATCATGAAGACAACGACGTCGTCTTCGTCGCTGCTTCTTCTTCTTCTT
CGTCTTCTCACTCCGTTGATTCTTCGGCGGCTTTAGCTTCGGATGAATGCTCAGCTACATCCACCGCAGAAGAAAACGAT
CAGAGCTCATCGAGTATCAGCTCCGGTTGTTGTTTCACCAATCAATCCAAAGAAATCGCGAAGAACCGTTCGACGTTTGT
TACAGATCTGGAGGCTCATCAAATCTCAGAAACCGAAACCAAAACCTCAACATTAATCAATAGCAATTTCAGAAGAGAGA
CAAGTCCAGTGAGCGAGGGGTTGGGAGAAACAACAACGGAGATGGAATCATCATCCGCGGCGGAGGTGAGGAAAACACCA
ACGCCGGCGGAGATAGAGGGTTTTTTCTCTGAGTTAGAAAATGAAGCAGACGACAAGAAGAAGCAATTCATAGAAAAGTA
CAACTTCGATATTGTCAATGACGAACCGCTTCAAGGTCGCTACAAGTGGGATCGACTTTAA