Details for Capsella Locus Carubv10014632m

Position : scaf_3 ( 5`- 3448031 .. 3449064 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014632m

Protein [Map View]
MIDPLKPRSMTTTSRKNTHWCNTCRRGIRLQGEGRRGGACIHCGDTFLERLYENVELSPFDLFGLAFEEARNRRRNNRSR
PVLGDQPTFEELFNRLSAQDRRGPPPASPTAINSLQKIKIRQKHLGLDLCCPVCQDRFEIGSDARKMPCKHIYHSECIAP
WLVQRNSCPVCRKELPQDRNNGWKKPLMYLWPFRSSGLASNHNISQPFH*

DNA
ATGATCGATCCATTAAAACCCCGATCCATGACTACAACTAGCCGAAAGAACACACATTGGTGTAATACTTGCAGACGAGG
AATCCGTCTACAAGGAGAAGGCAGAAGAGGAGGAGCTTGCATTCACTGTGGTGACACCTTTCTTGAAAGGCTATATGAGA
ACGTCGAACTAAGCCCTTTTGATCTCTTCGGTTTAGCCTTTGAAGAAGCTCGTAATCGTCGCCGCAACAACAGAAGTAGA
CCCGTTCTCGGAGACCAACCAACTTTTGAAGAGTTGTTTAACCGGCTCTCAGCACAAGACCGCCGTGGTCCTCCTCCAGC
GTCACCAACCGCGATCAACTCGTTACAAAAGATCAAAATCAGACAGAAGCATCTCGGTTTGGATCTGTGTTGCCCTGTTT
GCCAAGACCGGTTCGAAATAGGATCGGATGCAAGAAAGATGCCGTGTAAACATATATACCATTCGGAATGTATAGCCCCG
TGGTTAGTCCAGCGTAACTCTTGCCCTGTATGCCGCAAAGAACTGCCACAAGACAGAAACAATGGCTGGAAAAAACCATT
GATGTATCTGTGGCCGTTCAGGTCCTCTGGTTTGGCCTCGAACCACAATATATCACAACCTTTCCATTGA