Details for Capsella Locus Carubv10014626m

Position : scaf_3 ( 5`- 3987021 .. 3988331 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014626m

Protein [Map View]
MEVLDFKCSDVGIWKEALSSYESRIESLNKPDLVSLDQFYRIKLPCLLHDRDPNPYLTTSELCQLMKWKLTRGKWRPRLL
DFVSSLDDSVVKSASEKAFKSLPDISKAVKELTVLKGVGPATASAVLAAYAPDIAPFMSDEAMEVALGSSKDYSLKQYLL
FVTKLDDKSKELKLKGEWDGPSDIERALWSCTVGAKSQPEKSSSGKKRKR*

DNA
ATGGAAGTACTAGACTTCAAGTGTTCCGATGTCGGAATTTGGAAAGAGGCTCTGTCTTCGTACGAGTCCCGAATCGAGTC
ACTGAACAAGCCAGACCTCGTCTCTCTCGACCAATTCTACCGCATCAAACTCCCTTGTCTTCTTCACGACAGAGACCCTA
ACCCTTACCTCACCACCTCTGAGCTTTGTCAACTCATGAAATGGAAGCTCACTCGCGGCAAATGGCGGCCGCGTCTGCTG
GATTTCGTGTCGTCTCTGGACGATTCAGTGGTGAAATCTGCTTCTGAGAAAGCTTTCAAATCTCTCCCTGACATCTCCAA
GGCTGTGAAAGAGCTCACCGTTCTTAAGGGCGTTGGTCCGGCCACCGCCTCCGCTGTTCTTGCTGCTTACGCCCCTGACA
TTGCACCCTTTATGTCCGACGAGGCAATGGAGGTGGCTCTTGGTAGCTCAAAGGATTACTCTTTGAAGCAATACTTGCTG
TTTGTAACTAAACTAGATGATAAATCAAAGGAATTAAAGTTGAAGGGAGAGTGGGATGGGCCTTCAGATATTGAAAGAGC
TCTATGGAGCTGTACTGTGGGTGCAAAGTCACAACCAGAGAAGAGCTCTTCGGGGAAGAAAAGAAAACGTTAG